PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G274300.1
Common NameB456_006G274300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 176aa    MW: 19852.4 Da    PI: 10.4514
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G274300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.4e-1498143247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++WT+eE+  ++ + ++lG+g+W+ I++ +  +Rt+ q+ s+ qky
  Gorai.006G274300.1  98 KPWTEEEHRTFLAGLRKLGKGDWRGISKSFVPTRTPTQVASHAQKY 143
                         58****************************99*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.565722IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.18892148IPR017930Myb domain
SuperFamilySSF466891.52E-1794148IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-1795147IPR006447Myb domain, plants
SMARTSM007175.2E-1196146IPR001005SANT/Myb domain
PfamPF002491.8E-1298143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-1298142IPR009057Homeodomain-like
CDDcd001676.31E-1199144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MVKEAGRKCS HCGHNGHNSR TCYVHNSRCC NGKGGCVKLF GVKIGAMDQK RENVMKKSFS  60
MGNLQSHAEN NNDDDGYFSD GQIQSKKHKA SHERKRGKPW TEEEHRTFLA GLRKLGKGDW  120
RGISKSFVPT RTPTQVASHA QKYFLRQAGT DKKKRRPSLF DMEFQESGSV RYSLD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151155KKKRR
2151156KKKRRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487667.11e-126PREDICTED: uncharacterized protein LOC105800854 isoform X1
SwissprotQ2V9B03e-30MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0D2QHP91e-130A0A0D2QHP9_G
STRINGfgenesh2_kg.8__2146__AT5G61620.15e-61(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-63MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]